PDB entry 2eby

View 2eby on RCSB PDB site
Description: Crystal structure of a hypothetical protein from E. Coli
Class: transcription
Keywords: Hypothetical protein, JW0472, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-02-09, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.228
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative HTH-type transcriptional regulator ybaQ
    Species: Escherichia coli [TaxId:562]
    Gene: ybaQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebya_
  • Chain 'B':
    Compound: Putative HTH-type transcriptional regulator ybaQ
    Species: Escherichia coli [TaxId:562]
    Gene: ybaQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebyb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ebyA (A:)
mkqatrkpttpgdillyeylepldlkinelaellhvhrnsvsalinnnrklttemafrla
kvfdttvdfwlnlqaavdlwevennmrtqeelgrietvaeylarreerakkva

    Sequence, based on observed residues (ATOM records): (download) 
    >2ebyA (A:)
kpttpgdillyeylepldlkinelaellhvhrnsvsalinnnrklttemafrlakvfdtt
vdfwlnlqaavdlwevennmrtqeelgrietvaeylarreer

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ebyB (B:)
mkqatrkpttpgdillyeylepldlkinelaellhvhrnsvsalinnnrklttemafrla
kvfdttvdfwlnlqaavdlwevennmrtqeelgrietvaeylarreerakkva

    Sequence, based on observed residues (ATOM records): (download) 
    >2ebyB (B:)
kpttpgdillyeylepldlkinelaellhvhrnsvsalinnnrklttemafrlakvfdtt
vdfwlnlqaavdlwevennmrtqeelgrietvaeylar