PDB entry 2ebu

View 2ebu on RCSB PDB site
Description: Solution structure of the BRCT domain from human replication factor C large subunit 1
Class: replication
Keywords: a/b/a 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-02-09, released 2007-08-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication factor C subunit 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35251 (7-111)
      • cloning artifact (0-6)
    Domains in SCOPe 2.04: d2ebua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ebuA (A:)
    gssgssgkalgskeipkgaencleglifvitgvlesierdeakslieryggkvtgnvskk
    tnylvmgrdsgqsksdkaaalgtkiidedgllnlirtmpgkkskyeiavete