PDB entry 2ebt

View 2ebt on RCSB PDB site
Description: Solution structure of three tandem repeats of zf-C2H2 domains from human Kruppel-like factor 5
Class: transcription
Keywords: C2H2-type zinc-finger, metal bind, transcription factor, kruppel-like factor, GC-box promoter elements, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-02-09, released 2008-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Krueppel-like factor 5
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13887 (7-99)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2ebta1, d2ebta2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ebtA (A:)
  gssgssgpdlekrrihycdypgctkvytksshlkahlrthtgekpykctwegcdwrfars
  deltrhyrkhtgakpfqcgvcnrsfsrsdhlalhmkrhqn