PDB entry 2ebo

View 2ebo on RCSB PDB site
Description: core structure of gp2 from ebola virus
Deposited on 1998-12-24, released 1999-05-18
The last revision was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ebola virus envelope glycoprotein
  Species: Zaire ebolavirus [TaxId:128952]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05320 (0-73)
    • engineered mutation (52)
• Chain 'B':
  Compound: ebola virus envelope glycoprotein
  Species: Zaire ebolavirus [TaxId:128952]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05320 (0-73)
    • engineered mutation (52)
• Chain 'C':
  Compound: ebola virus envelope glycoprotein
  Species: Zaire ebolavirus [TaxId:128952]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05320 (0-73)
    • engineered mutation (52)
• Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >2eboA (A:)
  glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
  knitdkidqiihdf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >2eboB (B:)
  glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
  knitdkidqiihdf
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >2eboC (C:)
  glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
  knitdkidqiihdf