PDB entry 2ebn

View 2ebn on RCSB PDB site
Description: crystal structure of endo-beta-n-acetylglucosaminidase f1, an alpha(slash)beta-barrel enzyme adapted for a complex substrate
Class: hydrolase
Keywords: hydrolase(glucosidase)
Deposited on 1994-08-30, released 1995-01-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-beta-n-acetylglucosaminidase f1
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ebna_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ebnA (A:)
    avtgttkaniklfsftevndtnplnnlnftlknsgkplvdmvvlfsaninydaandkvfv
    snnpnvqhlltnrakylkplqdkgikvilsilgnhdrsgianlstarakafaqelkntcd
    lynldgvffddeysayqtpppsgfvtpsnnaaarlayetkqampnklvtvyvysrtssfp
    tavdgvnagsyvdyaihdyggsydlatnypglaksgmvmssqefnqgryataqalrnivt
    kgygghmifamdpnrsnftsgqlpalkliakelygdelvysntpyskdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebnA (A:)
    ttkaniklfsftevndtnplnnlnftlknsgkplvdmvvlfsaninydaandkvfvsnnp
    nvqhlltnrakylkplqdkgikvilsilgnhdrsgianlstarakafaqelkntcdlynl
    dgvffddeysayqtpppsgfvtpsnnaaarlayetkqampnklvtvyvysrtssfptavd
    gvnagsyvdyaihdyggsydlatnypglaksgmvmssqefnqgryataqalrnivtkgyg
    ghmifamdpnrsnftsgqlpalkliakelygdelvysntpyskdw