PDB entry 2ebm

View 2ebm on RCSB PDB site
Description: Solution structure of the RWD domain of human RWD domain containing protein 1
Class: structural genomics, unknown function
Keywords: RWD domain, alpha+beta sandwich fold, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2007-02-09, released 2007-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RWD domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RWDD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H446 (7-127)
      • cloning artifact (0-6)
    Domains in SCOPe 2.08: d2ebma1, d2ebma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ebmA (A:)
    gssgssgmtdygeeqrnelealesiypdsftvlsenppsftitvtseagendetvqttlk
    ftysekypdeaplyeifsqenledndvsdilkllalqaeenlgmvmiftlvtavqeklne
    ivdqiktr