PDB entry 2ebl

View 2ebl on RCSB PDB site
Description: Solution structure of the Zinc finger, C4-type domain of human COUP transcription factor 1
Class: transcription
Keywords: DNA-binding, Metal-binding, Nuclear protein, Receptor, Transcription, Transcription regulation, Zinc, EAR3, ERBAL3, TFCOUP1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-02-09, released 2008-02-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COUP transcription factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR2F1, EAR3, ERBAL3, TFCOUP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10589 (7-82)
      • expression tag (0-6)
      • expression tag (83-88)
    Domains in SCOPe 2.05: d2ebla_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eblA (A:)
    gssgssgiecvvcgdkssgkhygqftcegcksffkrsvrrnltytcranrncpidqhhrn
    qcqycrlkkclkvgmrreavqrgsgpssg