PDB entry 2ebf

View 2ebf on RCSB PDB site
Description: Crystal structures reveal a thiol-protease like catalytic triad in the C-terminal region of Pasteurella multocida toxin
Class: toxin
Keywords: Pasteurella multocida toxin, Trojan horse-like fold, TOXIN
Deposited on 2007-02-08, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Dermonecrotic toxin
    Species: Pasteurella multocida [TaxId:747]
    Gene: toxA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ebfx1, d2ebfx2, d2ebfx3
  • Heterogens: 2PO, TRE, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2ebfX (X:)
    mghhhhhhdydipttenlyfqgahmgiqrvsnakllggspyspfriglegvwtpevlkar
    asvigkpigesykrilaklqrihnsnilderqglmhelmelidlyeesqpsserlnafre
    lrtqlekalylpemealkkqilqipnkgsgaarfllrtamnemagktsestadlirfalq
    dtvisapfrgyagaipeaidfpvkyviedisvfdkiqtnywelpayeswnegsnsallpg
    llresqskgmlskcriienslyighsyeemfysispysnqvggpyelypftffsmlqevq
    gdlgfeqafatrnffntlvsdrlslmentmlltesfdytpwdaiygdinydeqfaamsin
    eriekcmntyrgvafqnssksidfflnnlttfidnglteiaisdlpydivqqeisqflqg
    snewktldamlfnldkgdingafrkllqsakdnnikfraighsdnsvppfnnpykslyyk
    gniiaeaiekldregqkfvvfadssllnstpgtgrpmpglvqylkipatvvdsdgawqfl
    pdvassrvpievtelenwqvltppqgkilglkqfkltagfpteqsrlpllensvsedlre
    elmqkidaikndvkmnslvcmeagscdsvspkvaarlkdmgleagmgasitwwrreggme
    fshqmhttasfkfagkefavdashlqfvhdqldttililpvddwaleiaqrnrainpfve
    yvsktgnmlalfmpplftkprltral
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ebfX (X:)
    lggspyspfriglegvwtpevlkarasvigkpigesykrilaklqrihnsnilderqglm
    helmelidlyeesqpsserlnafrelrtqlekalylpemealkkqilqipnkgsgaarfl
    lrtamnemagktsestadlirfalqdtvisapfrgyagaipeaidfpvkyviedisvfdk
    iqtnywelpayeswnegsnsallpgllresqskgmlskcriienslyighsyeemfysis
    pysnqvggpyelypftffsmlqevqgdlgfeqafatrnffntlvsdrlslmentmlltes
    fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn
    glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni
    kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr
    pmpglvqylkipatvvdsdgawqflpdvassrvpievtelenwqvltppqgkilglkqfk
    ltagfpteqsrlpllensvsedlreelmqkidaikndvkmnslvcmeagscdsvspkvaa
    rlkdmgleagmgasitwwrreggmefshqmhttasfkfagkefavdashlqfvhdqldtt
    ililpvddwaleiaqrnrainpfveyvsktgnmlalfmpplftkprltral