PDB entry 2eb9

View 2eb9 on RCSB PDB site
Description: Crystal Structure of Cu(II)(Sal-Leu)/apo-Myoglobin
Class: oxygen storage/transport
Keywords: OXYGEN STORAGE/TRANSPORT, OXYGEN STORAGE-TRANSPORT complex
Deposited on 2007-02-07, released 2007-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eb9a_
  • Heterogens: PO4, CUS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eb9A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eb9A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshkipikylefiseaiihvlhsrhpgdf
    gadaqgamnkalelfrkdiaakykelgyqg