PDB entry 2eb2

View 2eb2 on RCSB PDB site
Description: Crystal structure of mutated EGFR kinase domain (G719S)
Class: transferase
Keywords: Kinase, Tyrosine-protein kinase, Receptor, Transferase, Phosphorylation, ATP-binding, Disease mutation, Transmembrane, Cell cycle, EC 2.7.10.1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-02-06, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • see remark 999 (30)
    Domains in SCOPe 2.07: d2eb2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eb2A (A:)
    gamgirsgeapnqallrilketefkkikvlssgafgtvykglwipegekvkipvaikelr
    eatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdn
    igsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeeke
    yhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissile
    kgerlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermh
    lpsptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eb2A (A:)
    geapnqallrilketefkkikvlssgtvykglwipegekvkipvaikelratspkankei
    ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaekeyhaeggkvpikw
    malesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppict
    idvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpedmddvvdad
    eylip