PDB entry 2eam

View 2eam on RCSB PDB site
Description: Solution structure of the N-terminal SAM-domain of a human putative 47 kDa protein
Class: signaling protein
Keywords: Cell-free protein synthesis, protein regulation, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-01-31, released 2007-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 47 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRX7 (7-73)
      • cloning artifact (0-6)
      • cloning artifact (74-79)
    Domains in SCOPe 2.08: d2eama1, d2eama2, d2eama3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eamA (A:)
    gssgssgprcpvqtvgqwlesiglpqyenhlmangfdnvqfmgsnvmedqdlleigilns
    ghrqrilqaiqllpsgpssg