PDB entry 2eak

View 2eak on RCSB PDB site
Description: Crystal structure of human galectin-9 N-terminal CRD in complex with lactose
Class: sugar binding protein
Keywords: beta sandwich, carbohydrate binding protein, galectin, SUGAR BINDING PROTEIN
Deposited on 2007-01-31, released 2007-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.226
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2eaka_
  • Chain 'B':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2eakb_
  • Chain 'C':
    Compound: Galectin-9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2eakc_
  • Heterogens: LBT, DTV, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eakA (A:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eakA (A:)
    sqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnpr
    fedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhr
    vpfhrvdtisvngsvqlsyisfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eakB (B:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eakB (B:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eakC (C:)
    mafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiaf
    hfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfv
    qyfhrvpfhrvdtisvngsvqlsyisfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eakC (C:)
    qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
    edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
    pfhrvdtisvngsvqlsyisfq