PDB entry 2ea9
View 2ea9 on RCSB PDB site
Description: Crystal structure of a hypothetical protein JW2626 from E.coli
Class: structural genomics, unknown function
Keywords: Escherichia coli, JW2626, hypothetical protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on
2007-01-31, released
2007-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Hypothetical protein yfjZ
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2ea9a_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2ea9A (A:)
msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavyptqr
Sequence, based on observed residues (ATOM records): (download)
>2ea9A (A:)
msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavypt