PDB entry 2ea9

View 2ea9 on RCSB PDB site
Description: Crystal structure of a hypothetical protein JW2626 from E.coli
Class: structural genomics, unknown function
Keywords: Escherichia coli, JW2626, hypothetical protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2007-01-31, released 2007-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yfjZ
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ea9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ea9A (A:)
    msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
    smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavyptqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ea9A (A:)
    msnttwglqrditprlgarlvqegnqlhyladrasitgkfsdaecpkldvvfphfisqie
    smlttgelnprhaqcvtlyhngftceadtlgscgyvyiavypt