PDB entry 2e9t

View 2e9t on RCSB PDB site
Description: Foot-and-mouth disease virus RNA-polymerase RNA dependent in complex with a template-primer RNA and 5F-UTP
Class: transferase/RNA
Keywords: Foot-and-mouth disease virus, RNA-dependent RNA polymerase, 3D polymerase, polymerase, TRANSFERASE-RNA COMPLEX
Deposited on 2007-01-26, released 2007-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-dependent RNA polymerase
    Species: Foot-and-mouth disease virus [TaxId:244367]
    Gene: 3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0QEE1 (0-469)
      • cloning artifact (470-473)
    Domains in SCOPe 2.06: d2e9ta2, d2e9ta3
  • Chain 'B':
    Compound: 5'-r(p*up*ap*gp*gp*gp*cp*cp*c)-3'
  • Chain 'C':
    Compound: 5'-r(*gp*gp*gp*cp*cp*cp*(5fu))-3'
  • Chain 'D':
    Compound: RNA-dependent RNA polymerase
    Species: Foot-and-mouth disease virus [TaxId:244367]
    Gene: 3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0QEE1 (0-469)
      • cloning artifact (470-473)
    Domains in SCOPe 2.06: d2e9td2, d2e9td3
  • Chain 'E':
    Compound: 5'-r(p*up*ap*gp*gp*gp*cp*cp*c)-3'
  • Chain 'F':
    Compound: 5'-r(*gp*gp*gp*cp*cp*cp*(5fu))-3'
  • Heterogens: MG, PPV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e9tA (A:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaalehh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9tA (A:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaale
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e9tD (D:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaalehh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9tD (D:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaale
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.