PDB entry 2e9o

View 2e9o on RCSB PDB site
Description: Structure of h-CHK1 complexed with AA582939
Class: transferase
Keywords: Protein-inhibitor Complex, TRANSFERASE
Deposited on 2007-01-26, released 2008-01-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2e9oa_
  • Heterogens: A58, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e9oA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplk