PDB entry 2e9f

View 2e9f on RCSB PDB site
Description: Crystal Structure of T.th.HB8 Argininosuccinate lyase complexed with L-Arginine
Class: lyase
Keywords: alpha helix bundle, LYASE
Deposited on 2007-01-25, released 2007-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Lyase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e9fa_
  • Chain 'B':
    Compound: Argininosuccinate Lyase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e9fb_
  • Chain 'C':
    Compound: Argininosuccinate Lyase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e9fc_
  • Chain 'D':
    Compound: Argininosuccinate Lyase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e9fd_
  • Heterogens: ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e9fA (A:)
    mahrtwggrfgegpdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleai
    lkgldrieeeieagtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrl
    ylrgaidellalllalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlk
    rdagrledakerlnesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfale
    vlsalnigmlhlsrmaeelilysteefgfvevpdafatgssimpqkknpdilelirakag
    rvlgafvglsavvkglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermw
    raaeggytlateladylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplf
    aedalpllrletaihrrrsyggtapeavrerleeakkevgld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9fA (A:)
    pdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleailkgldrieeeiea
    gtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrlylrgaidellall
    lalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlkrdagrledakerl
    nesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfalevlsalnigmlhls
    rmaeelilysteefgfvevpdafatgssimpqkknpdilelirakagrvlgafvglsavv
    kglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermwraaeggytlatel
    adylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplfaedalpllrleta
    ihrrrsyggtapeavrerleeakkevgld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e9fB (B:)
    mahrtwggrfgegpdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleai
    lkgldrieeeieagtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrl
    ylrgaidellalllalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlk
    rdagrledakerlnesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfale
    vlsalnigmlhlsrmaeelilysteefgfvevpdafatgssimpqkknpdilelirakag
    rvlgafvglsavvkglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermw
    raaeggytlateladylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplf
    aedalpllrletaihrrrsyggtapeavrerleeakkevgld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9fB (B:)
    gpdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleailkgldrieeeie
    agtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrlylrgaidellal
    llalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlkrdagrledaker
    lnesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfalevlsalnigmlhl
    srmaeelilysteefgfvevpdafatgssimpqkknpdilelirakagrvlgafvglsav
    vkglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermwraaeggytlate
    ladylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplfaedalpllrlet
    aihrrrsyggtapeavrerleeakkevgld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e9fC (C:)
    mahrtwggrfgegpdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleai
    lkgldrieeeieagtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrl
    ylrgaidellalllalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlk
    rdagrledakerlnesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfale
    vlsalnigmlhlsrmaeelilysteefgfvevpdafatgssimpqkknpdilelirakag
    rvlgafvglsavvkglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermw
    raaeggytlateladylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplf
    aedalpllrletaihrrrsyggtapeavrerleeakkevgld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9fC (C:)
    pdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleailkgldrieeeiea
    gtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrlylrgaidellall
    lalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlkrdagrledakerl
    nesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfalevlsalnigmlhls
    rmaeelilysteefgfvevpdafatgssimpqkknpdilelirakagrvlgafvglsavv
    kglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermwraaeggytlatel
    adylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplfaedalpllrleta
    ihrrrsyggtapeavrerleeakkevgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e9fD (D:)
    mahrtwggrfgegpdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleai
    lkgldrieeeieagtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrl
    ylrgaidellalllalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlk
    rdagrledakerlnesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfale
    vlsalnigmlhlsrmaeelilysteefgfvevpdafatgssimpqkknpdilelirakag
    rvlgafvglsavvkglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermw
    raaeggytlateladylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplf
    aedalpllrletaihrrrsyggtapeavrerleeakkevgld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e9fD (D:)
    gpdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleailkgldrieeeie
    agtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrlylrgaidellal
    llalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlkrdagrledaker
    lnesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfalevlsalnigmlhl
    srmaeelilysteefgfvevpdafatgssimpqkknpdilelirakagrvlgafvglsav
    vkglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermwraaeggytlate
    ladylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplfaedalpllrlet
    aihrrrsyggtapeavrerleeakkevgl