PDB entry 2e8j

View 2e8j on RCSB PDB site
Description: Solution structure of dynein light chain 2A
Class: transport protein
Keywords: homodimer, TRANSPORT PROTEIN
Deposited on 2007-01-21, released 2008-01-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2e8ja_
  • Chain 'B':
    Compound: Dynein light chain 2A, cytoplasmic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2e8jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e8jA (A:)
    gplgsmaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkars
    tvrdidpqndltflrirskkneimvapdkdyfliviqnpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e8jA (A:)
    maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
    dpqndltflrirskkneimvapdkdyfliviqnpte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e8jB (B:)
    gplgsmaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkars
    tvrdidpqndltflrirskkneimvapdkdyfliviqnpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e8jB (B:)
    maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
    dpqndltflrirskkneimvapdkdyfliviqnpte