PDB entry 2e89

View 2e89 on RCSB PDB site
Description: Crystal structure of Aquifex aeolicus TilS in a complex with ATP, Magnesium ion, and L-lysine
Class: ligase
Keywords: Rossmann-fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-01-19, released 2007-11-13
The last revision prior to the SCOP 1.75 freeze date was dated 2007-11-13, with a file datestamp of 2007-11-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.229
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA(Ile)-lysidine synthase
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e89a1, d2e89a2
  • Chain 'B':
    Compound: tRNA(Ile)-lysidine synthase
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e89b1, d2e89b2
  • Chain 'C':
    Compound: tRNA(Ile)-lysidine synthase
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e89c1, d2e89c2
  • Chain 'D':
    Compound: tRNA(Ile)-lysidine synthase
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e89d1, d2e89d2
  • Heterogens: MG, LYS, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e89A (A:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcfspev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e89B (B:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcfspev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e89B (B:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e89C (C:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcfspev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e89C (C:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e89D (D:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcfspev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e89D (D:)
    mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
    fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
    lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
    akfkglrwvedetnyevsiprnrirhrvipelkrinenledtflkmvkvlraerefleee
    aqklykevkkgncldvkklkekplalqrrvirkfigekdyekvelvrsllekggevnlgk
    gkvlkrkerwlcf