PDB entry 2e7u

View 2e7u on RCSB PDB site
Description: Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from Thermus thermophilus HB8
Class: isomerase
Keywords: PLP enzyme, GSA, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ISOMERASE
Deposited on 2007-01-14, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e7ua_
  • Heterogens: NA, PMP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e7uA (A:)
    merpiseayfqeakrhipggvsspvrafkavggtppflvrgegayvwdadgnryldyvms
    wgplilghahpkvlarvretlergltfgapsplevalakkvkraypfvdlvrfvnsgtea
    tmsalrlargytgrpyivkfrgnyhghadgllveagsgaltlgvpssagvpeeyakltlv
    leyndpeglrevlkrrgeeiaaiifepvvgnagvlvptedflkalheakaygvlliadev
    mtgfrlafggatellglkpdlvtlgkilggglpaaayagrreimekvaplgpvyqagtls
    gnplamaaglatlelleenpgyyayledlgarleaglkevlkekglphtvnrvgsmitvf
    ftegpvvtfqdarrtdtelfkrffhglldrgiywppsnfeaaflsvahreedvektleal
    rkal