PDB entry 2e7s

View 2e7s on RCSB PDB site
Description: Crystal structure of the yeast Sec2p GEF domain
Class: endocytosis/exocytosis
Keywords: coiled coil
Deposited on 2007-01-12, released 2007-02-27
The last revision prior to the SCOP 1.75 freeze date was dated 2007-03-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sa1
  • Chain 'B':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sb1
  • Chain 'C':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sc1
  • Chain 'D':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sd1
  • Chain 'E':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7se1
  • Chain 'F':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sf1
  • Chain 'G':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
    Domains in SCOP 1.75: d2e7sg1
  • Chain 'H':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
    Domains in SCOP 1.75: d2e7sh1
  • Chain 'I':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7si1
  • Chain 'J':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
    Domains in SCOP 1.75: d2e7sj1
  • Chain 'K':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sk1
  • Chain 'L':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sl1
  • Chain 'M':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sm1
  • Chain 'N':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
    Domains in SCOP 1.75: d2e7sn1
  • Chain 'O':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7so1
  • Chain 'P':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7sp1
  • Chain 'Q':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
    Domains in SCOP 1.75: d2e7sq1
  • Chain 'R':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
    Domains in SCOP 1.75: d2e7sr1
  • Chain 'S':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7ss1
  • Chain 'T':
    Compound: Rab guanine nucleotide exchange factor SEC2
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17065 (5-End)
      • engineered (89)
      • engineered/modified residue (95)
      • engineered/modified residue (116)
    Domains in SCOP 1.75: d2e7st1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e7sA (A:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sA (A:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e7sB (B:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sB (B:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtltlq
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e7sC (C:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sC (C:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e7sD (D:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sD (D:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtltlq
    lknl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2e7sE (E:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sE (E:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtltlq
    lknl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2e7sF (F:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sF (F:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtltlq
    lknl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2e7sG (G:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sG (G:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2e7sH (H:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sH (H:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteql
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2e7sI (I:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sI (I:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmll
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2e7sJ (J:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sJ (J:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteql
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2e7sK (K:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sK (K:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2e7sL (L:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sL (L:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmll
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2e7sM (M:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sM (M:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2e7sN (N:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sN (N:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekd
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2e7sO (O:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sO (O:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtltlq
    lknl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2e7sP (P:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sP (P:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmll
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2e7sQ (Q:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sQ (Q:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekd
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2e7sR (R:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sR (R:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekd
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2e7sS (S:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sS (S:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2e7sT (T:)
    gplgsleeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakene
    lrtkaeeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlld
    tltlqlknlkkvmhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7sT (T:)
    leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
    eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmll