PDB entry 2e7o

View 2e7o on RCSB PDB site
Description: Solution structure of the Bromodomain from human Bromodomain adjacent to zinc finger domain 2B
Class: DNA binding protein
Keywords: Bromodomain, Bromodomain adjacent to zinc finger domain 2B, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2007-01-11, released 2007-07-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain adjacent to zinc finger domain 2B
  Species: Homo sapiens [TaxId:9606]
  Gene: BAZ2B, KIAA1476
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UIF8 (7-111)
    • cloning artifact (0-6)
  Domains in SCOPe 2.05: d2e7oa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e7oA (A:)
  gssgssgdskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirekl
  ssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk