PDB entry 2e7l

View 2e7l on RCSB PDB site
Description: Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9
Class: immune system
Keywords: tcr, MHC, immune system
Deposited on 2007-01-11, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxic Tcell receptor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTU7 (0-111)
      • engineered mutation (42)
      • engineered mutation (81)
      • engineered mutation (93-97)
    Domains in SCOPe 2.07: d2e7la_
  • Chain 'B':
    Compound: Cytotoxic Tcell receptor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTU7
      • engineered mutation (42)
      • engineered mutation (81)
      • engineered mutation (93-97)
    Domains in SCOPe 2.07: d2e7lb_
  • Chain 'C':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (0-109)
      • engineered mutation (16)
      • engineered mutation (41)
      • engineered mutation (46)
      • engineered mutation (76)
      • engineered mutation (79)
      • engineered mutation (95)
      • engineered mutation (98)
      • engineered mutation (102)
      • engineered mutation (107)
      • see remark 999 (110-111)
    Domains in SCOPe 2.07: d2e7lc_
  • Chain 'D':
    Compound: Beta-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2NTY6 (0-109)
      • engineered mutation (16)
      • engineered mutation (41)
      • engineered mutation (46)
      • engineered mutation (76)
      • engineered mutation (79)
      • engineered mutation (95)
      • engineered mutation (98)
      • engineered mutation (102)
      • engineered mutation (107)
      • see remark 999 (110-111)
    Domains in SCOPe 2.07: d2e7ld_
  • Chain 'E':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-End)
      • engineered mutation (14)
      • engineered mutation (29)
      • engineered mutation (48)
      • engineered mutation (65)
      • engineered mutation (96)
      • engineered mutation (130)
  • Chain 'F':
    Compound: H-2 class I histocompatibility antigen, L-D alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01897 (0-End)
      • engineered mutation (14)
      • engineered mutation (29)
      • engineered mutation (48)
      • engineered mutation (65)
      • engineered mutation (96)
      • engineered mutation (130)
  • Chain 'P':
    Compound: peptide (GLN)(LEU)(SER)(PRO)(PHE)(PRO)(PHE)(ASP)(LEU)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2E7L (0-8)
  • Chain 'Q':
    Compound: peptide (GLN)(LEU)(SER)(PRO)(PHE)(PRO)(PHE)(ASP)(LEU)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2E7L (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e7lA (A:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhrsdsavyfcavshqgryltfgsgtkvivlpyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7lA (A:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhrsdsavyfcavshqgryltfgsgtkvivlpy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e7lB (B:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhrsdsavyfcavshqgryltfgsgtkvivlpyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7lB (B:)
    svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvng
    feaefsksnssfhlrkasvhrsdsavyfcavshqgryltfgsgtkvivlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e7lC (C:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvlssalehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7lC (C:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvlss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e7lD (D:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvlssalehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7lD (D:)
    eaavtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghelrliyysygagstekgdi
    pdgykasrpsqenfsltlesatpsqtsvyfcasggggtlyfgagtrlsvlss
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.