PDB entry 2e7k

View 2e7k on RCSB PDB site
Description: Solution structure of the PDZ domain from Human MAGUK p55 subfamily member 2
Class: membrane protein
Keywords: PDZ domain, MAGUK p55 subfamily member 2, MPP2 protein, Discs large homolog 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
Deposited on 2007-01-10, released 2008-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAGUK p55 subfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MPP2, DLG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14168 (7-84)
      • expression tag (0-6)
      • expression tag (85-90)
    Domains in SCOPe 2.07: d2e7ka1, d2e7ka2, d2e7ka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2e7kA (A:)
gssgssgrmvgirktagehlgvtfrveggelviarilhggmvaqqgllhvgdiikevngq
pvgsdpralqellrnasgsvilkilsgpssg