PDB entry 2e7e

View 2e7e on RCSB PDB site
Description: Bent-binding of cyanide to the heme iron in rat heme oxygenase-1
Class: Oxidoreductase
Keywords: ligand, heme, binding geometry
Deposited on 2007-01-09, released 2007-06-19
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-19, with a file datestamp of 2007-06-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.194
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2e7ea1
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e7eA (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7eA (A:)
    qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
    npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
    ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
    mtpevkhrvteeaktafllnielfeelqallt