PDB entry 2e7a

View 2e7a on RCSB PDB site
Description: TNF Receptor Subtype One-selective TNF Mutant with Antagonistic Activity
Class: cytokine
Keywords: Tumor necrosis factor, Trimer, antagonistic activity, TNFR1 specific, phage display system, CYTOKINE
Deposited on 2007-01-09, released 2007-11-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (64)
      • engineered (83-89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
    Domains in SCOPe 2.02: d2e7aa_
  • Chain 'B':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (64)
      • engineered (83-89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
    Domains in SCOPe 2.02: d2e7ab_
  • Chain 'C':
    Compound: Tumor necrosis factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01375 (Start-156)
      • engineered (10)
      • engineered (64)
      • engineered (83-89)
      • engineered (97)
      • engineered (111)
      • engineered (127)
    Domains in SCOPe 2.02: d2e7ac_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e7aA (A:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisristthnqpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7aA (A:)
    psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
    gcpsthvllthtisristthnqpvnllsairspcqretpegaeanpwyepiylggvfqle
    pgdrlsaeinrpdyldfaesgqvyfgiial
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e7aB (B:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisristthnqpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7aB (B:)
    psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
    gcpsthvllthtisristthnqpvnllsairspcqanpwyepiylggvfqlepgdrlsae
    inrpdyldfaesgqvyfgiial
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e7aC (C:)
    vrsssrtpsdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliys
    qvlfsgqgcpsthvllthtisristthnqpvnllsairspcqretpegaeanpwyepiyl
    ggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e7aC (C:)
    psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
    gcpsthvllthtisristthnqpvnllsairspcqranpwyepiylggvfqlepgdrlsa
    einrpdyldfaesgqvyfgiial