PDB entry 2e77

View 2e77 on RCSB PDB site
Description: Crystal structure of L-lactate oxidase with pyruvate complex
Class: oxidoreductase
Keywords: tim barrel, fmn, oxidoreductase
Deposited on 2007-01-06, released 2007-11-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2e77a_
  • Chain 'B':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2e77b_
  • Chain 'C':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2e77c_
  • Chain 'D':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2e77d_
  • Heterogens: FMN, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e77A (A:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e77A (A:)
    ynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllyprl
    aqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysga
    tfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvkn
    kfvypfgmpivqnniygaskqkisprdieeiaghsglpvfvkgiqhpedadmaikrgasg
    iwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvvalg
    rpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e77B (B:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e77B (B:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvk
    nkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfvkgiqhp
    edadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehva
    kalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlf
    dnpygyey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e77C (C:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e77C (C:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvk
    nkfvypfgmiygaskqkisprdieeiaghsglpvfvkgiqhpedadmaikrgasgiwvsn
    hgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvvalgrpvlf
    glalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e77D (D:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e77D (D:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvk
    nkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfvkgiqhp
    edadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehva
    kalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlf
    dnpygyey