PDB entry 2e6y

View 2e6y on RCSB PDB site
Description: Covalent complex of orotidine 5'-monophosphate decarboxylase (ODCase) with 6-Iodo-UMP
Class: lyase
Keywords: tim-barrel, LYASE
Deposited on 2007-01-05, released 2007-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.162
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (103)
    Domains in SCOPe 2.06: d2e6ya_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • see remark 999 (103)
    Domains in SCOPe 2.06: d2e6yb_
  • Heterogens: U5P, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e6yA (A:)
    gshmrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiia
    efrkrfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemg
    revflltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsfl
    ispgvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdlripedpaankar
    keaelaaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6yA (A:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesikdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e6yB (B:)
    gshmrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiia
    efrkrfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemg
    revflltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsfl
    ispgvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdlripedpaankar
    keaelaaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6yB (B:)
    vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
    fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
    aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
    etlrfadaiivgrsiyladnpaaaaagiiesikdl