PDB entry 2e6u

View 2e6u on RCSB PDB site
Description: Crystal structure of hypothetical protein PH1109 from Pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: Rossmann-like, CoA binding, Structural Genomics Consortium for Research on Gene Expression System, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2007-01-03, released 2007-01-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: hypothetical protein PH1109
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: ph1109
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2e6ux_
  • Heterogens: CA, CL, COA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >2e6uX (X:)
meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
deagliivanrcmmreherllgek

    Sequence, based on observed residues (ATOM records): (download) 
    >2e6uX (X:)
meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
deagliivanrcmmreherllg