PDB entry 2e6s

View 2e6s on RCSB PDB site
Description: Solution structure of the PHD domain in RING finger protein 107
Class: cell cycle
Keywords: NMR, PHD domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE
Deposited on 2006-12-28, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UHRF2
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF2, NIRF, RNF107
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96PU4 (7-76)
      • cloning artifact (0-6)
      • see remark 999 (10)
    Domains in SCOPe 2.08: d2e6sa1, d2e6sa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2e6sA (A:)
gssgssgrndtecdlcggdpekkchscscrvcggkhepnmqllcdecnvayhiyclnppl
dkvpeeeywycpscktd