PDB entry 2e6q

View 2e6q on RCSB PDB site
Description: Solution structure of the Ig-like domain (615-713) from human Obscurin-like protein 1
Class: Structural protein
Keywords: Ig-like domain; Obscurin-like protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein
Deposited on 2006-12-28, released 2007-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Obscurin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: OBSL1, KIAA0657
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75147 (7-105)
      • cloning artifact (0-6)
      • cloning artifact (106-111)
    Domains in SCOPe 2.06: d2e6qa1, d2e6qa2, d2e6qa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e6qA (A:)
    gssgssgtarlvagledvqvydgedavfsldlstiiqgtwflngeelksnepegqvepga
    lryrieqkglqhrlilhavkhqdsgalvgfscpgvqdsaaltiqessgpssg