PDB entry 2e6o

View 2e6o on RCSB PDB site
Description: Solution structure of the HMG box domain from human HMG-box transcription factor 1
Class: transcription, cell cycle
Keywords: HMG-box domain, HMG box containing protein 1, HMG-box transcription factor 1, High mobility group box transcription factor 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION, CELL CYCLE
Deposited on 2006-12-28, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HMG box-containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: HBP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60381 (7-86)
    • cloning artifact (0-6)
  Domains in SCOPe 2.08: d2e6oa1, d2e6oa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e6oA (A:)
  gssgssggtvsatspnkckrpmnafmlfakkyrveytqmypgkdnraisvilgdrwkkmk
  neerrmytleakalaeeqkrlnpdcwk