PDB entry 2e6f

View 2e6f on RCSB PDB site
Description: Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with oxonate
Class: oxidoreductase
Keywords: Chagas disease, Pyrimidine Biosynthesis, Dihydroorotate Dehydrogenase, Fumarate Reductase, Energy Metabolism, Redox Homeostasis, Flavoprotein, OXIDOREDUCTASE
Deposited on 2006-12-26, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.166
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: TCDHOD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6fa_
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: TCDHOD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6fb_
  • Heterogens: NCO, FMN, OXC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e6fA (A:)
    mmclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpepry
    mafplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaq
    ekgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaa
    avlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyr
    rcpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgy
    rtleefrgrvktie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6fA (A:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvkti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e6fB (B:)
    mmclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpepry
    mafplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaq
    ekgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaa
    avlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyr
    rcpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgy
    rtleefrgrvktie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6fB (B:)
    mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
    afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
    kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
    vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
    cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
    tleefrgrvkti