PDB entry 2e6c

View 2e6c on RCSB PDB site
Description: Crystal structure of the stationary phase survival protein SurE from Thermus thermophilus HB8 cocrystallized with manganese and AMP
Class: Hydrolase
Keywords: SurE protein, cocrystal structure with manganese ion and AMP, Hydrolase
Deposited on 2006-12-26, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.208
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6ca_
  • Chain 'B':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6cb_
  • Chain 'C':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6cc_
  • Chain 'D':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6cd_
  • Heterogens: MN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e6cA (A:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6cA (A:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e6cB (B:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6cB (B:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdthaitiahpvrayphpsplhaphfp
    ayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaa
    fsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvv
    ipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptlah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e6cC (C:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6cC (C:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e6cD (D:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6cD (D:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdthaitiahpvrayphpsplhaphfp
    ayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaa
    fsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvv
    ipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt