PDB entry 2e6b

View 2e6b on RCSB PDB site
Description: Crystal structure of the stationary phase survival protein SurE from Thermus thermophilus HB8 in complex with magnesium and tungstate
Class: Hydrolase
Keywords: SurE protein, complex with magnesium and tungstate ions, Hydrolase
Deposited on 2006-12-26, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6ba_
  • Chain 'B':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6bb_
  • Chain 'C':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6bc_
  • Chain 'D':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6bd_
  • Heterogens: MG, WO4, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e6bA (A:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6bA (A:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdtghaitiahpvrayphpsplhaphf
    payrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaa
    afsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegv
    vipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e6bB (B:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6bB (B:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdthaitiahpvrayphpsplphfpay
    rvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafs
    vplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvip
    gedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e6bC (C:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6bC (C:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdthaitiahpvrayphpsplhaphfp
    ayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaa
    fsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvv
    ipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e6bD (D:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6bD (D:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdthaitiahpvrayphpsplhaphfp
    ayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaa
    fsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvv
    ipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl