PDB entry 2e69

View 2e69 on RCSB PDB site
Description: Crystal structure of the stationary phase survival protein SurE from Thermus thermophilus HB8 in complex with sulfate
Class: Hydrolase
Keywords: SurE protein, Hydrolase
Deposited on 2006-12-26, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e69a_
  • Chain 'B':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e69b_
  • Chain 'C':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e69c_
  • Chain 'D':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e69d_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e69A (A:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e69A (A:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdghaitiahpvrayphpsplhaphfp
    ayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaa
    fsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvv
    ipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptlah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e69B (B:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e69B (B:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdhaitiahpvrayphpspphfpayrv
    rgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvp
    lngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipge
    dpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e69C (C:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e69C (C:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdhaitiahpvrayphpsplhaphfpa
    yrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaaf
    svplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvi
    pgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e69D (D:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e69D (D:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdhaitiahpvrayphpsplhaphfpa
    yrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaaf
    svplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvi
    pgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptl