PDB entry 2e65

View 2e65 on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3, Mutation D104A
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, X-ray Diffraction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-12-25, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.2
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: bpl
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (103)
    Domains in SCOPe 2.07: d2e65a1, d2e65a2
  • Chain 'B':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: bpl
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (103)
    Domains in SCOPe 2.07: d2e65b1, d2e65b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e65A (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e65A (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmgespegglwlsivlsp
    kvpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegkgdkivlgi
    glnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmil
    gvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e65B (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e65B (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgspegglwlsivls
    pkvpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegkgdkivlg
    iglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmi
    lgvrvkilgdgsfegiaediddfgrliirldsgevkkvivslrfl