PDB entry 2e64

View 2e64 on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii, Mutations R48A and K111A
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-12-25, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: bpl
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (110)
    Domains in SCOPe 2.07: d2e64a1, d2e64a2
  • Chain 'B':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: bpl
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (47)
      • engineered (110)
    Domains in SCOPe 2.07: d2e64b1, d2e64b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e64A (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e64A (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmespegglwlsivlspk
    vpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegkgdkivlgig
    lnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilg
    vrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e64B (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl