PDB entry 2e54

View 2e54 on RCSB PDB site
Description: Crystal structure of acetylornithine aminotransferase from Thermotoga maritima
Class: transferase
Keywords: argD, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2006-12-19, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine aminotransferase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e54a_
  • Heterogens: NA, PLP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e54A (A:)
    mylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshprlveaikdqaekl
    ihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarkygkkksekkyril
    sahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkmsedvcavflepi
    qgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqkygvvpdvlttak
    glgggvpigavivneranvlepgdhgttfggnplacragvtvikeltkegfleeveekgn
    ylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkllvvpagnntirf
    lppltveygeidlavetlkkvlqgi