PDB entry 2e53

View 2e53 on RCSB PDB site
Description: Crystal structure of basic winged bean lectin in complex with B blood group disaccharide
Class: sugar binding protein
Keywords: Winged bean, jelly roll
Deposited on 2006-12-18, released 2007-06-26
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-26, with a file datestamp of 2007-06-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e53a1
  • Chain 'B':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e53b1
  • Chain 'C':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e53c1
  • Chain 'D':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e53d1
  • Heterogens: CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e53A (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e53A (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e53B (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e53B (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e53C (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e53C (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e53D (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e53D (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg