PDB entry 2e4o

View 2e4o on RCSB PDB site
Description: X-ray Crystal Structure of Aristolochene Synthase from Aspergillus terreus and the Evolution of Templates for the Cyclization of Farnesyl Diphosphate
Class: lyase
Keywords: sesquiterpene cyclase, farnesyl diphosphate, LYASE
Deposited on 2006-12-15, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aristolochene synthase
    Species: Aspergillus terreus [TaxId:33178]
    Gene: Ari1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e4oa_
  • Chain 'B':
    Compound: Aristolochene synthase
    Species: Aspergillus terreus [TaxId:33178]
    Gene: Ari1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e4ob_
  • Chain 'C':
    Compound: Aristolochene synthase
    Species: Aspergillus terreus [TaxId:33178]
    Gene: Ari1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e4oc_
  • Chain 'D':
    Compound: Aristolochene synthase
    Species: Aspergillus terreus [TaxId:33178]
    Gene: Ari1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e4od_
  • Heterogens: CL, MES, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e4oA (A:)
    mkkpngtngassslepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagf
    srvtclyfpkalddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdr
    sipveyiiydlwesmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvg
    kellaalmrfsmglklspselqrvreidancskhlsvvndiysyekelytsktahseggi
    lctsvqilaqeadvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegley
    qmsgnelwsqttlrysvvvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4oA (A:)
    slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal
    ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw
    esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm
    glklspselqrvreidancskhlsvvndiysyekelytlctsvqilaqeadvtaeaakrv
    lfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttlrysv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e4oB (B:)
    mkkpngtngassslepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagf
    srvtclyfpkalddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdr
    sipveyiiydlwesmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvg
    kellaalmrfsmglklspselqrvreidancskhlsvvndiysyekelytsktahseggi
    lctsvqilaqeadvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegley
    qmsgnelwsqttlrysvvvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4oB (B:)
    slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal
    ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw
    esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm
    glklspselqrvreidancskhlsvvndiysyekelyilctsvqilaqeadvtaeaakrv
    lfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttlrysv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e4oC (C:)
    mkkpngtngassslepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagf
    srvtclyfpkalddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdr
    sipveyiiydlwesmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvg
    kellaalmrfsmglklspselqrvreidancskhlsvvndiysyekelytsktahseggi
    lctsvqilaqeadvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegley
    qmsgnelwsqttlrysvvvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4oC (C:)
    slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal
    ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw
    esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm
    glklspselqrvreidancskhlsvvndiysyekelytilctsvqilaqeadvtaeaakr
    vlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttlrysv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e4oD (D:)
    mkkpngtngassslepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagf
    srvtclyfpkalddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdr
    sipveyiiydlwesmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvg
    kellaalmrfsmglklspselqrvreidancskhlsvvndiysyekelytsktahseggi
    lctsvqilaqeadvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegley
    qmsgnelwsqttlrysvvvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4oD (D:)
    slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal
    ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw
    esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm
    glklspselqrvreidancskhlsvvndiysyekelylctsvqilaqeadvtaeaakrvl
    fvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttlrysv