PDB entry 2e4l

View 2e4l on RCSB PDB site
Description: Thermodynamic and Structural Analysis of Thermolabile RNase HI from Shewanella oneidensis MR-1
Class: hydrolase
Keywords: hydrolase, endoribonuclease, RNase HI, Shewanella oneidensis MR-1
Deposited on 2006-12-13, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hi
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: rnhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2e4la_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e4lA (A:)
    mtelklihiftdgsclgnpgpggygivmnykghtkemsdgfslttnnrmellapivalea
    lkepckiiltsdsqymrqgimtwihgwkkkgwmtsnrtpvknvdlwkrldkaaqlhqidw
    rwvkghaghaenercdqlaraaaeanptqidtgyqaes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4lA (A:)
    lklihiftdgsclgnpgpggygivmnykghtkemsdgfslttnnrmellapivalealke
    pckiiltsdsqymrqgimtwihgwkkkgwmtsnrtpvknvdlwkrldkaaqlhqidwrwv
    kghaghaenercdqlaraaaeanptqidtgyqaes