PDB entry 2e4h

View 2e4h on RCSB PDB site
Description: Solution structure of cytoskeletal protein in complex with tubulin tail
Class: structural protein
Keywords: NMR, cytoskeleton, CAP-Gly, complex structure, tubulin, solution structure, CLIP, STRUCTURAL PROTEIN
Deposited on 2006-12-08, released 2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Restin
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIP-170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2e4ha_
  • Chain 'B':
    Compound: Tubulin alpha-ubiquitous chain
    Species: Homo sapiens [TaxId:9606]
    Gene: a3-tubulin
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e4hA (A:)
    gsikkgerelkigdrvlvggtkagvvrflgetdfakgewcgveldeplgkndgavagtry
    fqcqpkyglfapvhkvtkigfpsttpakakanavrrvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4hA (A:)
    relkigdrvlvggtkagvvrflgetdfakgewcgveldeplgkndgavagtryfqcqpky
    glfapvhkvtkigf
    

  • Chain 'B':
    No sequence available.