PDB entry 2e4f

View 2e4f on RCSB PDB site
Description: Crystal Structure of the Cytoplasmic Domain of G-Protein-Gated Inward Rectifier Potassium Channel Kir3.2
Class: transport protein
Keywords: cytoplasmic assembly, ion channel, beta-barrel, TRANSPORT PROTEIN
Deposited on 2006-12-06, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G protein-activated inward rectifier potassium channel 2
    Species: Mus musculus [TaxId:10090]
    Gene: Kcnj6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48542
      • see remark 999 (86)
      • see remark 999 (139)
      • see remark 999 (170)
    Domains in SCOPe 2.07: d2e4fa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e4fA (A:)
    gshmrkiqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnsh
    iveasiraklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfwe
    iskaqlpkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdy
    nsfhetyetstpslsakelaelanraev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e4fA (A:)
    iqryvrkdgkcnvhhgnaetlvfsthavismrdgklclmfrvgdlriveasirakliksk
    qtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpkeeleiv
    vilegmveatgmtcqarssyitseilwgyrftpvltlgfyevdynsfhetyetstpslsa
    kelaelanrae