PDB entry 2e47

View 2e47 on RCSB PDB site
Description: Crystal Structure Analysis of the clock protein EA4 (glycosylation form)
Class: metal binding protein
Keywords: motalloprotein, glycoprotein, METAL BINDING PROTEIN
Deposited on 2006-12-05, released 2007-12-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.174
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Time interval measuring enzyme TIME
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2e47a_
  • Chain 'B':
    Compound: Time interval measuring enzyme TIME
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2e47b_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e47A (A:)
    hhgfttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsgg
    clstgshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigra
    vvlhekaddygksdhpdsrktgnaggrvacgvigil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e47A (A:)
    hgfttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsggc
    lstgshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigrav
    vlhekaddygksdhpdsrktgnaggrvacgvigil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e47B (B:)
    hhgfttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsgg
    clstgshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigra
    vvlhekaddygksdhpdsrktgnaggrvacgvigil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e47B (B:)
    ttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsggclst
    gshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigravvlh
    ekaddygksdhpdsrktgnaggrvacgvigil