PDB entry 2e45

View 2e45 on RCSB PDB site
Description: Solution structure of Fe65 WW domain
Class: protein binding
Keywords: triple-stranded beta-sheet, PROTEIN BINDING
Deposited on 2006-12-04, released 2006-12-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 precursor protein-binding family B member 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2e45a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e45A (A:)
    gplgsdsfwnpnafetdsdlpagwmrvqdtsgtyywhiptgttqweppgraspsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e45A (A:)
    dsfwnpnafetdsdlpagwmrvqdtsgtyywhiptgttqweppgraspsq