PDB entry 2e43

View 2e43 on RCSB PDB site
Description: Crystal structure of C/EBPbeta Bzip homodimer K269A mutant bound to A High Affinity DNA fragment
Class: transcription/DNA
Keywords: protein-DNA complex, transcription/DNA
Deposited on 2006-12-01, released 2007-12-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCAAT/enhancer-binding protein beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CEBPB, TCF5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2e43a_
  • Chain 'B':
    Compound: CCAAT/enhancer-binding protein beta
    Species: Homo sapiens [TaxId:9606]
    Gene: CEBPB, TCF5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2e43b_
  • Chain 'C':
    Compound: DNA (5'-d(p*dtp*dap*dgp*dgp*dap*dtp*dtp*dgp*dcp*dgp*dcp*dap*dap*dtp*dap*dt)-3')
  • Chain 'D':
    Compound: DNA (5'-d(p*dap*dap*dtp*dap*dtp*dtp*dgp*dcp*dgp*dcp*dap*dap*dtp*dcp*dcp*dt)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e43A (A:)
    vkskakktvdahsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkve
    qlsrelstlrnlfkqlpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e43A (A:)
    sdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnl
    fk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e43B (B:)
    vkskakktvdahsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkve
    qlsrelstlrnlfkqlpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e43B (B:)
    sdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnl
    fkql
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.