PDB entry 2e3h

View 2e3h on RCSB PDB site
Description: Crystal structure of the CLIP-170 CAP-Gly domain 2
Class: structural protein
Keywords: CAP-Gly, Cytoplasmic linker, tubulin binding, STRUCTURAL PROTEIN
Deposited on 2006-11-26, released 2007-08-28
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-28, with a file datestamp of 2007-08-24.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.193
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Restin
    Species: HOMO SAPIENS
    Gene: CLIP-170
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e3ha1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2e3hA (A:)
elkigdrvlvggtkagvvrflgetdfakgewcgveldeplgkndgavagtryfqcqpkyg
lfapvhkvtkigfpsttpakakanavrrvm

    Sequence, based on observed residues (ATOM records): (download) 
    >2e3hA (A:)
elkigdrvlvggtkagvvrflgetdfakgewcgveldeplgkndgavagtryfqcqpkyg
lfapvhkvtkigfpstvrrvm