PDB entry 2e36

View 2e36 on RCSB PDB site
Description: L11 with SANS refinement
Class: RNA binding protein
Keywords: l11, sans
Deposited on 2006-11-20, released 2007-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-19, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e36a1, d2e36a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2e36A (A:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
eaaarmiagsarsmgvevvgapevkda