PDB entry 2e34

View 2e34 on RCSB PDB site
Description: L11 structure with RDC and RG refinement
Class: RNA binding protein
Keywords: L11, ribosome, RNA BINDING PROTEIN
Deposited on 2006-11-20, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2e34a1, d2e34a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2e34A (A:)
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
eaaarmiagsarsmgvevvgapevkda