PDB entry 2e33

View 2e33 on RCSB PDB site
Description: Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
Class: ligase/hydrolase
Keywords: ubiquitin, SCF, Fbs1, RNaseB, LIGASE-HYDROLASE COMPLEX
Deposited on 2006-11-20, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F-box only protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80UW2 (Start-196)
      • see remark 999 (50)
    Domains in SCOPe 2.07: d2e33a_
  • Chain 'B':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e33b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e33A (A:)
    gshmgsadeerdhwqqfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdng
    veftqddsvkkyfassfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagsl
    yeltvrllsenedvlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvyw
    kgwfgarvtnssvwvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e33A (A:)
    rrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfassfewcrk
    aqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvlaefatgq
    vavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwvep
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e33B (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv